PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009607557.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 397aa    MW: 45150 Da    PI: 6.7065
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009607557.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.61.7e-51151441128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvka..eekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                     +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi+++d++k+ePwd+++       +   +++wyfFs++dkky+tg+r+nrat++g+Wkatg+d
  XP_009607557.1  15 VPPGFRFHPTEEELLHYYLRKKVACEKIDL-DVIRDIDLNKLEPWDIQEkcriG--GstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRD 106
                     69****************************.9***************9534332..222556********************************* PP

             NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     k ++s + + +g++ktLvfykgrap+g+k+dW+mheyrl
  XP_009607557.1 107 KVIHS-NCKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 144
                     ***99.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5711175IPR003441NAC domain
PROSITE profilePS5100556.21815175IPR003441NAC domain
PfamPF023651.4E-2716144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MSKDMNLSVN GQSQVPPGFR FHPTEEELLH YYLRKKVACE KIDLDVIRDI DLNKLEPWDI  60
QEKCRIGGST PQNDWYFFSH KDKKYPTGTR TNRATAAGFW KATGRDKVIH SNCKRIGMRK  120
TLVFYKGRAP HGQKSDWIMH EYRLDDNTTN PQDAVNASES SSPEEGWVVC RVFKKKNYHK  180
ALESPHQSSS AVSIMNSRTL IQKPNNDGVL DQILMYMGRS SCKQQDHESK HNINLVNNIN  240
NIHLDDHHMQ INSNSSFINT NSGTRFLHLP GLENHHSPTN NMDDDVSSLQ LIQQDCSFGH  300
ENMLTETEPC SGAGPSDWVA LDRLVASQLN GHVETSNNNL YFPLHNNGLQ LRTNRRPNDE  360
DDAFSQSQAA HDDDVEFWSY ARSSSSSPSD PLCHLSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-491217714167NO APICAL MERISTEM PROTEIN
1ut4_B5e-491217714167NO APICAL MERISTEM PROTEIN
1ut7_A5e-491217714167NO APICAL MERISTEM PROTEIN
1ut7_B5e-491217714167NO APICAL MERISTEM PROTEIN
4dul_A5e-491217714167NAC domain-containing protein 19
4dul_B5e-491217714167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607557.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-117NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM1AVV21e-178M1AVV2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000315711e-178(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-106NAC family protein